PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00136168001
Common NameGSBRNA2T00136168001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 375aa    MW: 42216.3 Da    PI: 7.806
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00136168001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.71.9e-31197251155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWt++LH++Fve+v+ LGG++kAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  GSBRNA2T00136168001 197 KTRIRWTQDLHDKFVECVNLLGGADKATPKAILKLMDSEGLTIFHVKSHLQKYRI 251
                          68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.234194254IPR017930Myb domain
SuperFamilySSF466895.73E-17196251IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-27196252IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-23197252IPR006447Myb domain, plants
PfamPF002494.2E-8201250IPR001005SANT/Myb domain
PfamPF143792.5E-20280326IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MDNINYESSN ASQGSRLQLP PHPQPPQPFN LQDVNMIHYN QSSPLTIETF SGLPPYDCTA  60
NQSLPVQCSS SNPYPPLFHP CHHQASASLS LDQSQSMVPM QPLQDHHYLK PLYQRSCAND  120
FSATNASSAS YSLSFEASQD PQELCRRTYS NSNVTQLNFS SSHHQPKQTL SRFSSHSSFS  180
THGGFMASNS GAVIGNKTRI RWTQDLHDKF VECVNLLGGA DKATPKAILK LMDSEGLTIF  240
HVKSHLQKYR IAKYIPDSQE GKFEKINCSK ELLDTKTGAH IKEALQLQLD VQRHLHEQLE  300
IQRNLQLRIE EQGKQLKIMI EQQQKTKECL LKTPNAEVSL SHSDSDHSIL RQSQYKKPKP  360
CCSQDMETVN SNQR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00136168001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013715394.10.0PREDICTED: transcription repressor KAN1-like isoform X1
TrEMBLA0A078BZF70.0A0A078BZF7_BRANA; BnaA10g24150D protein
STRINGBra009228.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54762748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.11e-155G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]